TA343974 PABPC5 antibody

Rabbit Polyclonal Anti-PABPC5 Antibody

See related secondary antibodies

Search for all "PABPC5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat PABPC5

Product Description for PABPC5

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat PABPC5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PABPC5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PABP-5, PABP5, Poly(A)-binding protein 5, Polyadenylate-binding protein 5
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96DU9
Immunogen:
The immunogen for anti-PABPC5 antibody: synthetic peptide directed towards the N terminal of human PABPC5. Synthetic peptide located within the following region: DAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLDKSIDNR.
GeneID:
140886
Application WB
Background PABPC5 binds the poly(A) tail of mR. PABPC5 may be involved in cytoplasmic regulatory processes of mR metabolism. PABPC5 can probably bind to cytoplasmic R sequences other than poly(A) in vivo.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PABPC5 (5 products)

Catalog No. Species Pres. Purity   Source  

PABPC5 (full length, N-term HIS tag)

PABPC5 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

PABPC5

PABPC5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PABPC5

PABPC5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PABPC5

PABPC5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PABPC5

PABPC5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for PABPC5 (2 products)

Catalog No. Species Pres. Purity   Source  

PABPC5 293T Cell Transient Overexpression Lysate(Denatured)

PABPC5 293T Cell Transient Overexpression Lysate(Denatured) Transient overexpression cell lysate was tested with Anti-PABPC5 antibody (H00140886-B01) by Western Blots.
  Abnova Taiwan Corp.

PABPC5 Lysate

Western Blot: PABPC5 Lysate [NBL1-14057] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PABPC5
  Novus Biologicals Inc.
  • LinkedIn