TA343979 TTC14 antibody

Rabbit Polyclonal Anti-TTC14 Antibody

See related secondary antibodies

Search for all "TTC14"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Rabbit, Rat TTC14

Product Description for TTC14

Rabbit anti Canine, Equine, Guinea Pig, Human, Rabbit, Rat TTC14.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TTC14

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1980, TPR repeat protein 14, Tetratricopeptide repeat protein 14
Presentation Purified
Reactivity Can, Eq, GP, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96N46
Immunogen:
The immunogen for anti-TTC14 antibody: synthetic peptide directed towards the N terminal of human TTC14. Synthetic peptide located within the following region: LLSLLRSEQQDNPHFRSLLGSAAEPARGPPPQHPLQGRKEKRVDNIEIQK.
GeneID:
151613
Application WB
Background TTC14 belongs to the TTC14 family and contains 1 S1 motif domain and 4 TPR repeats. The functions of TTC14 remain unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for TTC14 (2 products)

Catalog No. Species Pres. Purity   Source  

TTC14 Lysate

Western Blot: TTC14 Lysate [NBL1-17398] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TTC14
  Novus Biologicals Inc.

TTC14 overexpression lysate

TTC14 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn