TA343981 hnRNP-L like / HNRPLL antibody

Rabbit Polyclonal Anti-HNRPLL Antibody

See related secondary antibodies

Search for all "hnRNP-L like / HNRPLL"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat hnRNP-L like / HNRPLL

Product Description for hnRNP-L like / HNRPLL

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat hnRNP-L like / HNRPLL.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for hnRNP-L like / HNRPLL

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BLOCK24, Heterogeneous nuclear ribonucleoprotein L-like, SRRF, Stromal RNA-regulating factor
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WVV9
Immunogen:
The immunogen for anti-HNRPLL antibody: synthetic peptide directed towards the N terminal of human HNRPLL. Synthetic peptide located within the following region: MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGG.
GeneID:
92906
Application WB
Background HNRPLL contains 3 RRM (R recognition motif) domains and may bind R and plays a role in mR processing.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for hnRNP-L like / HNRPLL (1 products)

Catalog No. Species Pres. Purity   Source  

hnRNP-L like / HNRPLL (transcript variant 1)

hnRNP-L like / HNRPLL Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for hnRNP-L like / HNRPLL (2 products)

Catalog No. Species Pres. Purity   Source  

HNRNPLL overexpression lysate

HNRNPLL overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

HNRPLL Lysate

Western Blot: HNRPLL Lysate [NBL1-11654] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HNRPLL
  Novus Biologicals Inc.
  • LinkedIn