TA343989 ADAD2 / TENRL antibody

Rabbit Polyclonal Anti-ADAD2 Antibody

See related secondary antibodies

Search for all "ADAD2 / TENRL"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ADAD2 / TENRL

Product Description for ADAD2 / TENRL

Rabbit anti Human ADAD2 / TENRL.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ADAD2 / TENRL

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Adenosine deaminase domain-containing protein 2, Testis nuclear RNA-binding protein-like
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NCV1
Immunogen:
Synthetic peptide directed towards the C terminal of human ADAD2
AA Sequence:
TPDTCRGLSLNWSLGDPGIEVVDVATGRVKANAALGPPSRLCKASFLRAF
GeneID:
161931
Application Western blotting (0.2 - 1.0 µg/ml)
Background ADAD2 belongs to the ADAD family, and contains 1 A to I editase domain and 1 DRBM (double-stranded RNA-binding) domain. The exact functions of ADAD2 remain unknown.
General Readings Ota,T., (2004) Nat. Genet. 36 (1), 40-45
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Dog, Guinea Pig, Horse
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for ADAD2 / TENRL (2 products)

Catalog No. Species Pres. Purity   Source  

ADAD2 / TENRL

ADAD2 / TENRL Human Purified
  Abnova Taiwan Corp.

ADAD2 / TENRL

ADAD2 / TENRL Human Purified
  Abnova Taiwan Corp.

Positive controls for ADAD2 / TENRL (1 products)

Catalog No. Species Pres. Purity   Source  

LOC161931 293T Cell Transient Overexpression Lysate(Denatured)

LOC161931 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn