TA344007 APOBEC3D antibody

Rabbit Polyclonal Anti-APOBEC3D Antibody

See related secondary antibodies

Search for all "APOBEC3D"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human APOBEC3D

TA344007

More Views

  • TA344007

Product Description for APOBEC3D

Rabbit anti Human APOBEC3D.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for APOBEC3D

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms A3D, APOBEC-3D, DNA dC->dU-editing enzyme APOBEC-3D
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96AK3
Immunogen:
Synthetic peptide directed towards N terminal of human APOBEC3D
AA Sequence:
SYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAE
GeneID:
140564
Application

Western blotting  (0.2 - 1 µg/ml).
Immunohistochemistry on paraffin embedded sections (2-8 µg/ml)

Background This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA.This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA.
General Readings "The APOBEC3 cytidine deaminases: an innate defensive network opposing exogenous retroviruses and endogenous retroelements." Chiu Y.L., Greene W.C. Annu. Rev. Immunol. 26:317-353(2008)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human.

Accessory Products

Proteins and/or Positive Controls

Proteins for APOBEC3D (2 products)

Catalog No. Species Pres. Purity   Source  

APOBEC3D

APOBEC3D Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

APOBEC3D

APOBEC3D Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn