TA344008 DCP2 antibody

Rabbit Polyclonal Anti-DCP2 Antibody

See related secondary antibodies

Search for all "DCP2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DCP2

Product Description for DCP2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DCP2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DCP2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NUDT20, Nucleoside diphosphate-linked moiety X motif 20, Nudix motif 20, hDpc, mRNA-decapping enzyme 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IU60
Immunogen:
The immunogen for anti-DCP2 antibody: synthetic peptide directed towards the middle region of human DCP2. Synthetic peptide located within the following region: KQYQDSPNQKKRTNGLQPAKQQNSLMKCEKKLHPRKLQDNFETDAVYDLP.
GeneID:
167227
Application WB
Background DCP2 is a key component of an mR-decapping complex required for removal of the 5-prime cap from mR prior to its degradation from the 5-prime end.DCP2 is a key component of an mR-decapping complex required for removal of the 5-prime cap from mR prior to its degradation from the 5-prime end (Fenger-Gron et al., 2005 [PubMed 16364915]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-539 AY135173.1 1-539 540-1992 AK090564.1 481-1933 1993-8947 AC008536.7 154323-161277
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DCP2 (2 products)

Catalog No. Species Pres. Purity   Source  

DCP2

DCP2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DCP2

DCP2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for DCP2 (1 products)

Catalog No. Species Pres. Purity   Source  

DCP2 293T Cell Transient Overexpression Lysate(Denatured)

DCP2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn