TA344010 RBM45 antibody

Rabbit Polyclonal Anti-DRB1 Antibody

See related secondary antibodies

Search for all "RBM45"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat RBM45

Product Description for RBM45

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat RBM45.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RBM45

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DRB1, DRBP1, Developmentally-regulated RNA-binding protein 1, RNA-binding motif protein 45, RNA-binding protein 45
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IUH3
Immunogen:
The immunogen for anti-DRB1 antibody: synthetic peptide directed towards the N terminal of human DRB1. Synthetic peptide located within the following region: MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGD.
GeneID:
129831
Application WB
Background DRB1 is R-binding protein with binding specificity for poly(C) and may play an important role in neural development.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for RBM45 (1 products)

Catalog No. Species Pres. Purity   Source  

RBM45 overexpression lysate

RBM45 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn