TA344018 Splicing factor 4 (SF4) antibody

Rabbit Polyclonal Anti-SF4 Antibody

See related secondary antibodies

Search for all "Splicing factor 4 (SF4)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Splicing factor 4 (SF4)

Product Description for Splicing factor 4 (SF4)

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Splicing factor 4 (SF4).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Splicing factor 4 (SF4)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms F23858, RBP, RNA-binding protein RBP
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IWZ8
Immunogen:
The immunogen for anti-SF4 antibody: synthetic peptide directed towards the middle region of human SF4. Synthetic peptide located within the following region: TFKALKEGREPDYSEYKEFKLTVENIGYQMLMKMGWKEGEGLGSEGQGIK.
GeneID:
57794
Application WB
Background SF4 is a member of the SURP family of splicing factors. SF4 is a member of the SURP family of splicing factors.[supplied by OMIM].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Splicing factor 4 (SF4) (1 products)

Catalog No. Species Pres. Purity   Source  

Splicing factor 4 (SF4)

Splicing factor 4 (SF4) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for Splicing factor 4 (SF4) (1 products)

Catalog No. Species Pres. Purity   Source  

SUGP1 overexpression lysate

SUGP1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn