TA344027 CPEB2 antibody

Rabbit Polyclonal Anti-CPEB2 Antibody

See related secondary antibodies

Search for all "CPEB2"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish CPEB2

Product Description for CPEB2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish CPEB2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CPEB2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CPE-BP2, CPE-binding protein 2, Cytoplasmic polyadenylation element-binding protein 2, hCPEB-2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z5Q1-2
Immunogen:
The immunogen for anti-CPEB2 antibody: synthetic peptide directed towards the middle region of human CPEB2. Synthetic peptide located within the following region: DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVL.
GeneID:
132864
Application WB
Background CPEB2 is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mR-binding protein that regulates cytoplasmic polyadenylation of mR as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptiolly ictive haploid spermatids.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn