TA344028 NSUN6 antibody

Rabbit Polyclonal Anti-NSUN6 Antibody

See related secondary antibodies

Search for all "NSUN6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit NSUN6

Product Description for NSUN6

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit NSUN6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NSUN6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NOPD1, Putative methyltransferase NSUN6
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TEA1
Immunogen:
The immunogen for anti-NSUN6 antibody: synthetic peptide directed towards the N terminal of human NSUN6. Synthetic peptide located within the following region: SIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPPS.
GeneID:
221078
Application WB
Background NSUN6 may have S-adenosyl-L-methionine-dependent methyl-transferase activity (Potential). NSUN6 belongs to the methyltransferase superfamily, RsmB/NOP family. It contains 1 PUA domain.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NSUN6 (1 products)

Catalog No. Species Pres. Purity   Source  

NSUN6

NSUN6 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for NSUN6 (1 products)

Catalog No. Species Pres. Purity   Source  

NSUN6 Lysate

Western Blot: NSUN6 Lysate [NBL1-13818] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NSUN6
  Novus Biologicals Inc.
  • LinkedIn