TA344030 TMED4 / ERS25 antibody

Rabbit Polyclonal Anti-TMED4 Antibody

See related secondary antibodies

Search for all "TMED4 / ERS25"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish TMED4 / ERS25

TA344030

More Views

  • TA344030

Product Description for TMED4 / ERS25

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish TMED4 / ERS25.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for TMED4 / ERS25

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Endoplasmic reticulum stress-response protein 25, HNLF, Putative NF-kappa-B-activating protein 156, Transmembrane emp24 domain-containing protein 4
Presentation Purified
Reactivity Bov, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z7H5
Immunogen:
The immunogen for anti-TMED4 antibody: synthetic peptide directed towards the N terminal of human TMED4. Synthetic peptide located within the following region: LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRT.
GeneID:
222068
Application WB
IHC
Background TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TMED4 / ERS25 (2 products)

Catalog No. Species Pres. Purity   Source  

TMED4 / ERS25

TMED4 / ERS25 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TMED4 / ERS25

TMED4 / ERS25 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TMED4 / ERS25 (2 products)

Catalog No. Species Pres. Purity   Source  

TMED4 293T Cell Transient Overexpression Lysate(Denatured)

TMED4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TMED4 overexpression lysate

TMED4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn