TA344032 ANKRD42 antibody

Rabbit Polyclonal Anti-ANKRD42 Antibody

See related secondary antibodies

Search for all "ANKRD42"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rat ANKRD42

Product Description for ANKRD42

Rabbit anti Bovine, Canine, Human, Mouse, Rat ANKRD42.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ANKRD42

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Ankyrin repeat domain-containing protein 42
Presentation Aff - Purified
Reactivity Bov, Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N9B4
Immunogen:
Synthetic peptide peptide directed towards the N terminal of human ANKRD42
AA Sequence:
PLHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAFHGRLGCLQLL
GeneID:
338699
Application Western blotting (0.2 - 1.0 µg/ml)
Background ANKRD42 is a 43 kDA 389 amino acid protein containing 9 ANK repeats. Its exact function remains unknown.
General Readings Ota,T., (2004) Nat. Genet. 36 (1), 40-45
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Bovine, Dog, Rabbit, Guinea Pig, Horse, Pig
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Positive controls for ANKRD42 (1 products)

Catalog No. Species Pres. Purity   Source  

ANKRD42 overexpression lysate

ANKRD42 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn