TA344060 WNT9B antibody

Rabbit Polyclonal Anti-WNT9B Antibody

See related secondary antibodies

Search for all "WNT9B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat WNT9B

Product Description for WNT9B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat WNT9B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for WNT9B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Protein Wnt-9b, UNQ6973/PRO21956, WNT14B, WNT15, Wnt-14b, Wnt-15
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O14905
Immunogen:
The immunogen for anti-WNT9B antibody: synthetic peptide directed towards the middle region of human WNT9B. Synthetic peptide located within the following region: CTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADA.
GeneID:
7484
Application WB
Background WNT9B is a ligand for members of the frizzled family of seven transmembrane receptors. WNT9B is a probable developmental protein. WNT9B may be a sigling molecule which affects the development of discrete regions of tissues. WNT9B is likely to sigl over only few cell diameters.The WNT gene family consists of structurally related genes that encode secreted sigling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. Study of its expression in the teratocarcinoma cell line NT2 suggests that it may be implicated in the early process of neurol differentiation of NT2 cells induced by retinoic acid. This gene is clustered with WNT3, another family member, in the chromosome 17q21 region.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for WNT9B (2 products)

Catalog No. Species Pres. Purity   Source  

WNT9B

WNT9B Human Purified
  Abnova Taiwan Corp.

WNT9B

WNT9B Human Purified
  Abnova Taiwan Corp.

Positive controls for WNT9B (2 products)

Catalog No. Species Pres. Purity   Source  

WNT9B Lysate

Western Blot: WNT9B Lysate [NBL1-17881] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for WNT9B
  Novus Biologicals Inc.

WNT9B overexpression lysate

WNT9B overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn