TA344072 CD344 / FZD4 / Frizzled-4 antibody

Rabbit Polyclonal Anti-FZD4 Antibody

See related secondary antibodies

Search for all "CD344 / FZD4 / Frizzled-4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rat CD344 / FZD4 / Frizzled-4

TA344072

More Views

  • TA344072

Product Description for CD344 / FZD4 / Frizzled-4

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rat CD344 / FZD4 / Frizzled-4.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for CD344 / FZD4 / Frizzled-4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Fz-4, FzE4, hFz4
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9ULV1
Immunogen:
The immunogen for anti-FZD4 antibody: synthetic peptide directed towards the middle region of human FZD4. Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV.
GeneID:
8322
Application WB
IHC
Background FZD4 is a member of the frizzled family. Members of this family are seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of sigling proteins. Most frizzled receptors are coupled to the beta-catenin canonical sigling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site sigling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of sigling proteins. Most frizzled receptors are coupled to the beta-catenin canonical sigling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site sigling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CD344 / FZD4 / Frizzled-4 (5 products)

Catalog No. Species Pres. Purity   Source  

CD344 / FZD4 / Frizzled-4

CD344 / FZD4 / Frizzled-4 Human
  Abnova Taiwan Corp.

CD344 / FZD4 / Frizzled-4

CD344 / FZD4 / Frizzled-4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

CD344 / FZD4 / Frizzled-4

CD344 / FZD4 / Frizzled-4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

CD344 / FZD4 / Frizzled-4

CD344 / FZD4 / Frizzled-4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD344 / FZD4 / Frizzled-4

CD344 / FZD4 / Frizzled-4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CD344 / FZD4 / Frizzled-4 (2 products)

Catalog No. Species Pres. Purity   Source  

Frizzled-4 Lysate

Western Blot: Frizzled-4 Lysate [NBL1-10890] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FZD4
  Novus Biologicals Inc.

FZD4 overexpression lysate

FZD4 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn