TA344086 NKD1 antibody

Rabbit Polyclonal Anti-NKD1 Antibody

See related secondary antibodies

Search for all "NKD1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat NKD1

TA344086

More Views

  • TA344086

Product Description for NKD1

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat NKD1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for NKD1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NKD, Naked-1, PP7246, Protein naked cuticle homolog 1, hNkd, hNkd1
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q969G9
Immunogen:
The immunogen for anti-NKD1 antibody: synthetic peptide directed towards the N terminal of human NKD1. Synthetic peptide located within the following region: ELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPG.
GeneID:
85407
Application WB
IHC
Background In the mouse, Nkd is a Dishevelled -binding protein that functions as a negative regulator of the Wnt-beta-catenin -Tcf sigling pathway.In the mouse, Nkd is a Dishevelled (see DVL1; MIM 601365)-binding protein that functions as a negative regulator of the Wnt (see WNT1; MIM 164820)-beta-catenin (see MIM 116806)-Tcf (see MIM 602272) sigling pathway.[supplied by OMIM].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn