TA344096 Interleukin-17B / IL17B antibody

Rabbit Polyclonal Anti-Il17b Antibody

See related secondary antibodies

Search for all "Interleukin-17B / IL17B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast Interleukin-17B / IL17B

Product Description for Interleukin-17B / IL17B

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast Interleukin-17B / IL17B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Interleukin-17B / IL17B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms IL-17B, IL20, Interleukin-20, NIRF, Neuronal interleukin-17-related factor, ZCYTO7
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9QXT6
Immunogen:
The immunogen for Anti-Il17b antibody is: synthetic peptide directed towards the N-terminal region of Rat Il17b. Synthetic peptide located within the following region: LLAISIFLVPSQPRNTKGKRKGQGRPGPLAPGPHQVPLDLVSRVKPYARM.
GeneID:
56069
Application WB
Background Human homolog is a T cell-derived cytokine that may be involved in the proinflammatory response.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn