TA344102 TMCC2 antibody

Rabbit Polyclonal Anti-TMCC2 Antibody

See related secondary antibodies

Search for all "TMCC2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat TMCC2

Product Description for TMCC2

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat TMCC2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMCC2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cerebral protein 11, KIAA0481, Transmembrane and coiled-coil domains protein 2
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75069
Immunogen:
The immunogen for anti-TMCC2 antibody: synthetic peptide directed towards the N terminal of human TMCC2. Synthetic peptide located within the following region: GETTGANSAGGPTSDAGAAAAPNPGPRSKPPDLKKIQQLSEGSMFGHGLK.
GeneID:
9911
Application WB
Background TMCC2 is a multi-pass membrane protein. It belongs to the TEX28 family. The function of TMCC2 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for TMCC2 (1 products)

Catalog No. Species Pres. Purity   Source  

TMCC2 overexpression lysate

TMCC2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn