TA344105 Mitofusin-2 antibody

Rabbit Polyclonal Anti-MFN2 Antibody

See related secondary antibodies

Search for all "Mitofusin-2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Mitofusin-2

Product Description for Mitofusin-2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Mitofusin-2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Mitofusin-2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CPRP1, Charcot-Marie-Tooth disease, KIAA0214, MFN2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95140
Immunogen:
The immunogen for anti-MFN2 antibody: synthetic peptide directed towards the C terminal of human MFN2. Synthetic peptide located within the following region: LEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR.
GeneID:
9927
Application WB
Background MFN2 is a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintence and operation of the mitochondrial network. It is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke.This gene encodes a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintence and operation of the mitochondrial network. This protein is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke. Two transcript variants encoding the same protein have been identified.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Mitofusin-2 (4 products)

Catalog No. Species Pres. Purity   Source  

Mitofusin-2 (transcript variant 2)

Mitofusin-2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Mitofusin-2 (transcript variant 1)

Mitofusin-2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Mitofusin-2

Mitofusin-2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Mitofusin-2

Mitofusin-2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Mitofusin-2 (3 products)

Catalog No. Species Pres. Purity   Source  

MFN2 Lysate

Western Blot: MFN2 Lysate [NBL1-13040] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MFN2
  Novus Biologicals Inc.

MFN2 overexpression lysate

MFN2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

MFN2 overexpression lysate

MFN2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn