TA344107 Cordon-bleu protein-like 1 antibody

Rabbit Polyclonal Anti-COBLL1 Antibody

See related secondary antibodies

Search for all "Cordon-bleu protein-like 1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human, Rabbit Cordon-bleu protein-like 1

Product Description for Cordon-bleu protein-like 1

Rabbit anti Canine, Human, Rabbit Cordon-bleu protein-like 1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Cordon-bleu protein-like 1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms COBLL1, KIAA0977
Presentation Purified
Reactivity Can, Hu, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q53SF7
Immunogen:
The immunogen for anti-COBLL1 antibody: synthetic peptide directed towards the middle region of human COBLL1. Synthetic peptide located within the following region: QAKPSSFFLQMQKRVSGHYVTSAAAKSVHAAPNPAPKELTNKEAERDMLP.
GeneID:
22837
Application WB
Background The function of COBLL1 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn