TA344118 GAPVD1 / RAP6 antibody

Rabbit Polyclonal Anti-GAPVD1 Antibody

See related secondary antibodies

Search for all "GAPVD1 / RAP6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish GAPVD1 / RAP6

TA344118

More Views

  • TA344118

Product Description for GAPVD1 / RAP6

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish GAPVD1 / RAP6.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for GAPVD1 / RAP6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GAPEX5, GAPex-5, GTPase-activating protein and VPS9 domain-containing protein 1, KIAA1521, Rab5-activating protein 6
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q14C86-6
Immunogen:
The immunogen for anti-GAPVD1 antibody: synthetic peptide directed towards the N terminal of human GAPVD1. Synthetic peptide located within the following region: FKLFSEGLFSAKLFLTATLHEPIMQLLVEDEDHLETDPNKLIERFSPSQQ.
GeneID:
26130
Application WB
IHC
Background GAPVD1 acts both as a GTPase-activating protein (GAP) and a guanine nucleotide exchange factor (GEF), and participates in various processes such as endocytosis, insulin receptor interlization or LC2A4/GLUT4 trafficking. It acts as a GEF for the Ras-related protein RAB31 by exchanging bound GDP for free GTP, leading to regulate LC2A4/GLUT4 trafficking. In the absence of insulin, it maintains RAB31 in an active state and promotes a futile cycle between LC2A4/GLUT4 storage vesicles and early endosomes, retaining LC2A4/GLUT4 inside the cells. Upon insulin stimulation, it is translocated to the plasma membrane, releasing LC2A4/GLUT4 from intracellular storage vesicles. It is also involved in EGFR trafficking and degradation, possibly by promoting EGFR ubiquitition and subsequent degradation by the proteasome. It has GEF activity for Rab5 and GAP activity for Ras.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn