TA344162 GTPBP2 antibody

Rabbit Polyclonal Anti-GTPBP2 Antibody

See related secondary antibodies

Search for all "GTPBP2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Rat, Zebrafish GTPBP2

TA344162

More Views

  • TA344162
  • TA344162

Product Description for GTPBP2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Rat, Zebrafish GTPBP2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GTPBP2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GTP-binding protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BX10
Immunogen:
The immunogen for anti-GTPBP2 antibody: synthetic peptide directed towards the N terminal of human GTPBP2. Synthetic peptide located within the following region: GCGGPKGKKKNGRNRGGKANNPPYLPPEAEDGNIEYKLKLVNPSQYRFEH.
GeneID:
54676
Application WB
Background GTP-binding proteins, or G proteins, constitute a superfamily capable of binding GTP or GDP. G proteins are activated by binding GTP and are ictivated by hydrolyzing GTP to GDP. This general mechanism ebles G proteins to perform a wide range of biologic activities. GTP-binding proteins, or G proteins, constitute a superfamily capable of binding GTP or GDP. G proteins are activated by binding GTP and are ictivated by hydrolyzing GTP to GDP. This general mechanism ebles G proteins to perform a wide range of biologic activities.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2966 BC064968.1 1-2966 2967-2996 BU736981.1 1-30 c
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GTPBP2 (2 products)

Catalog No. Species Pres. Purity   Source  

GTPBP2

GTPBP2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GTPBP2

GTPBP2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for GTPBP2 (1 products)

Catalog No. Species Pres. Purity   Source  

GTPBP2 293T Cell Transient Overexpression Lysate(Denatured)

GTPBP2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn