TA344170 ANKRD2 antibody

Rabbit Polyclonal Anti-ANKRD2 Antibody

See related secondary antibodies

Search for all "ANKRD2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ANKRD2

Product Description for ANKRD2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ANKRD2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ANKRD2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ARPP, Ankyrin repeat domain-containing protein 2, Skeletal muscle ankyrin repeat protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9GZV1
Immunogen:
The immunogen for anti-ANKRD2 antibody: synthetic peptide directed towards the N terminal of human ANKRD2. Synthetic peptide located within the following region: QEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSL.
GeneID:
26287
Application WB
Background ANKRD2 may play an important role in skeletal muscle hypertrophy.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ANKRD2 (2 products)

Catalog No. Species Pres. Purity   Source  

ANKRD2 (transcript variant 1)

ANKRD2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ANKRD2 (transcript variant 2)

ANKRD2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for ANKRD2 (3 products)

Catalog No. Species Pres. Purity   Source  

ANKRD2 Lysate

ANKRD2 Lysate [NBL1-07535] Protein
  Novus Biologicals Inc.

ANKRD2 overexpression lysate

ANKRD2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ANKRD2 overexpression lysate

ANKRD2 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn