TA344190 WNT3A antibody

Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region

See related secondary antibodies

Search for all "WNT3A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish WNT3A

TA344190

More Views

  • TA344190

Product Description for WNT3A

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish WNT3A.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for WNT3A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Protein Wnt-3a
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P56704
Immunogen:
The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP.
GeneID:
89780
Application WB
IHC
Background The WNT gene family consists of structurally related genes which encode secreted sigling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for WNT3A (5 products)

Catalog No. Species Pres. Purity   Source  

WNT3A (19-352, )

WNT3A Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

WNT3A (19-352, )

WNT3A Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

WNT3A

WNT3A Human Purified
  Abnova Taiwan Corp.

WNT3A

WNT3A Human Purified
  Abnova Taiwan Corp.

WNT3A

WNT3A Human Purified
  Abnova Taiwan Corp.

Positive controls for WNT3A (3 products)

Catalog No. Species Pres. Purity   Source  

WNT3A 293T Cell Transient Overexpression Lysate(Denatured)

WNT3A 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

Wnt3a Lysate

Western Blot: Wnt3a Lysate [NBL1-17870] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for WNT3A
  Novus Biologicals Inc.

WNT3A overexpression lysate

WNT3A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn