TA344192 PDGFD antibody

Rabbit Polyclonal Anti-PDGFD Antibody - N-terminal region

See related secondary antibodies

Search for all "PDGFD"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat PDGFD

Product Description for PDGFD

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat PDGFD.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PDGFD

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms IEGF, Iris-expressed growth factor, PDGF-D, Platelet-derived growth factor D, SCDGF-B, SCDGFB, Spinal cord-derived growth factor B
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9GZP0
Immunogen:
The immunogen for anti-PDGFD antibody: synthetic peptide directed towards the N terminal of human PDGFD. Synthetic peptide located within the following region: NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH.
GeneID:
80310
Application WB
Background The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines, seven of which are f
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PDGFD (7 products)

Catalog No. Species Pres. Purity   Source  

PDGFD (N-term HIS tag, transcript variant 1)

PDGFD Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

PDGFD (250-370, His-tag)

PDGFD Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

PDGFD (250-370, His-tag)

PDGFD Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

PDGFD

PDGFD Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PDGFD

PDGFD Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PDGFD

PDGFD Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PDGFD

PDGFD Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PDGFD (5 products)

Catalog No. Species Pres. Purity   Source  

PDGFD 293T Cell Transient Overexpression Lysate(Denatured)

PDGFD 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PDGFD overexpression lysate

PDGFD overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PDGFD overexpression lysate

PDGFD overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

SCDGFB Lysate

Western Blot: SCDGFB Lysate [NBL1-14237] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PDGFD
  Novus Biologicals Inc.

SCDGFB Lysate

Western Blot: SCDGFB Lysate [NBL1-14238] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PDGFD
  Novus Biologicals Inc.
  • LinkedIn