TA344214 SHB antibody

Rabbit Polyclonal Anti-SHB Antibody - N-terminal region

See related secondary antibodies

Search for all "SHB"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rabbit SHB

Product Description for SHB

Rabbit anti Bovine, Canine, Human, Mouse, Rabbit SHB.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SHB

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SH2 domain-containing adapter protein B
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15464
Immunogen:
The immunogen for anti-SHB antibody: synthetic peptide directed towards the N terminal of human SHB. Synthetic peptide located within the following region: MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSA.
GeneID:
6461
Application WB
Background SHB is the adapter protein which regulates several sigl transduction cascades by linking activated receptors to downstream sigling components. SHB may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR sigling. SHB may also play a rol
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SHB (1 products)

Catalog No. Species Pres. Purity   Source  

SHB (full length, N-term HIS tag)

SHB Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

Positive controls for SHB (1 products)

Catalog No. Species Pres. Purity   Source  

SHB overexpression lysate

SHB overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn