TA344215 Glycyl-tRNA synthetase antibody

Rabbit Polyclonal Anti-GARS Antibody - middle region

See related secondary antibodies

Search for all "Glycyl-tRNA synthetase"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Rabbit, Rat, Zebrafish Glycyl-tRNA synthetase

Product Description for Glycyl-tRNA synthetase

Rabbit anti Bovine, Canine, Guinea Pig, Rabbit, Rat, Zebrafish Glycyl-tRNA synthetase.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Glycyl-tRNA synthetase

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AP-4-A synthetase, Diadenosine tetraphosphate synthetase, GARS, GlyRS, Glycine-tRNA ligase, SMAD1
Presentation Purified
Reactivity Bov, Can, GP, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P41250
Immunogen:
The immunogen for anti-GARS antibody: synthetic peptide directed towards the middle region of human GARS. Synthetic peptide located within the following region: IEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQN.
GeneID:
2617
Application WB
Background GARS catalyzes the attachment of glycine to tR(Gly). Is also able produce diadenosine tetraphosphate (Ap4A), a universal pleiotropic sigling molecule needed for cell regulation pathways, by direct condensation of 2 ATPs.This gene encodes glycyl-tR synthetase, one of the aminoacyl-tR synthetases that charge tRs with their cogte amino acids. The encoded enzyme is an (alpha)2 dimer which belongs to the class II family of tR synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Glycyl-tRNA synthetase (6 products)

Catalog No. Species Pres. Purity   Source  

Glycyl-tRNA synthetase

Glycyl-tRNA synthetase Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Glycyl-tRNA synthetase (43-289, His-tag)

Glycyl-tRNA synthetase Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

Glycyl-tRNA synthetase (43-289, His-tag)

Glycyl-tRNA synthetase Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

Glycyl-tRNA synthetase

Glycyl-tRNA synthetase Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Glycyl-tRNA synthetase

Glycyl-tRNA synthetase Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Glycyl-tRNA synthetase

Glycyl-tRNA synthetase Human
  Abnova Taiwan Corp.

Positive controls for Glycyl-tRNA synthetase (2 products)

Catalog No. Species Pres. Purity   Source  

GARS 293T Cell Transient Overexpression Lysate(Denatured)

GARS 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

GARS Lysate

Western Blot: GARS Lysate [NBL1-10970] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GARS
  Novus Biologicals Inc.
  • LinkedIn