TA344221 DPPA5 / ESG1 antibody

Rabbit Polyclonal Anti-DPPA5 Antibody - N-terminal region

See related secondary antibodies

Search for all "DPPA5 / ESG1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human, Mouse, Porcine, Rabbit DPPA5 / ESG1

Product Description for DPPA5 / ESG1

Rabbit anti Canine, Human, Mouse, Porcine, Rabbit DPPA5 / ESG1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DPPA5 / ESG1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Developmental pluripotency-associated 5 protein, Embryonal stem cell-specific gene 1 protein
Presentation Purified
Reactivity Can, Hu, Ms, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NC42
Immunogen:
The immunogen for anti-DPPA5 antibody: synthetic peptide directed towards the N terminal of human DPPA5. Synthetic peptide located within the following region: MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV.
GeneID:
340168
Application WB
Background DPPA5 is involved in the maintence of embryonic stem (ES) cell pluripotency. DPPA5 is dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. DPPA5 is associates with specific target mRs.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DPPA5 / ESG1 (3 products)

Catalog No. Species Pres. Purity   Source  

DPPA5 / ESG1

DPPA5 / ESG1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

DPPA5 / ESG1 (1-116, His-tag)

DPPA5 / ESG1 Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

DPPA5 / ESG1 (1-116, His-tag)

DPPA5 / ESG1 Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

Positive controls for DPPA5 / ESG1 (2 products)

Catalog No. Species Pres. Purity   Source  

Dppa5 Lysate

Western Blot: Dppa5 Lysate [NBL1-10004] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DPPA5
  Novus Biologicals Inc.

DPPA5 overexpression lysate

DPPA5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn