TA344225 TMED10 / TMP21 antibody

Rabbit Polyclonal Anti-TMED10 Antibody - middle region

See related secondary antibodies

Search for all "TMED10 / TMP21"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Guinea Pig, Human, Porcine, Rat, Zebrafish TMED10 / TMP21

Product Description for TMED10 / TMP21

Rabbit anti Canine, Guinea Pig, Human, Porcine, Rat, Zebrafish TMED10 / TMP21.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMED10 / TMP21

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 21 kDa transmembrane-trafficking protein, S31I125, Transmembrane emp24 domain-containing protein 10, Transmembrane protein Tmp21
Presentation Purified
Reactivity Can, GP, Hu, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P49755
Immunogen:
The immunogen for anti-TMED10 antibody: synthetic peptide directed towards the middle region of human TMED10. Synthetic peptide located within the following region: KLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIF.
GeneID:
10972
Application WB
Background TMED10 is involved in vesicular protein trafficking.This gene is a member of the EMP24/GP25L/p24 family and encodes a protein with a GOLD domain. This type I membrane protein is localized to the plasma membrane and golgi cistere and is involved in vesicular protein trafficking. The protein is also a member of a heteromeric secretase complex and regulates the complex's gamma-secretase activity without affecting its epsilon-secretase activity. Mutations in this gene have been associated with early-onset familial Alzheimer's disease. This gene has a pseudogene on chromosome 8.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TMED10 / TMP21 (2 products)

Catalog No. Species Pres. Purity   Source  

TMED10 / TMP21 (32-185, His-tag)

TMED10 / TMP21 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €820.00
  OriGene Technologies GmbH

TMED10 / TMP21 (32-185, His-tag)

TMED10 / TMP21 Human Purified > 85 % by SDS - PAGE E. coli
20 µg / €320.00
  OriGene Technologies GmbH
  • LinkedIn