TA344266 Lambda-crystallin homolog antibody

Rabbit Polyclonal Anti-CRYL1 Antibody - N-terminal region

See related secondary antibodies

Search for all "Lambda-crystallin homolog"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rat, Yeast Lambda-crystallin homolog

Product Description for Lambda-crystallin homolog

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rat, Yeast Lambda-crystallin homolog.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Lambda-crystallin homolog

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CRY, CRYL1
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rt, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y2S2
Immunogen:
The immunogen for Anti-CRYL1 antibody is: synthetic peptide directed towards the N-terminal region of Human CRYL1. Synthetic peptide located within the following region: CVVIVGSGVIGRSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLE.
GeneID:
51084
Application WB
Background The urote cycle functions as an altertive glucose metabolic pathway, accounting for about 5% of daily glucose catabolism. The product of this gene catalyzes the dehydrogetion of L-gulote into dehydro-L-gulote in the urote cycle. The enzyme requires D(H) as a coenzyme, and is inhibited by inorganic phosphate. A similar gene in the rabbit is thought to serve a structural role in the lens of the eye.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Lambda-crystallin homolog (1 products)

Catalog No. Species Pres. Purity   Source  

Lambda-crystallin homolog

Lambda-crystallin homolog Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.
  • LinkedIn