TA344267 CEP70 antibody

Rabbit Polyclonal Anti-CEP70 Antibody - N-terminal region

See related secondary antibodies

Search for all "CEP70"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CEP70

Product Description for CEP70

Rabbit anti Human CEP70.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CEP70

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BITE, Centrosomal protein of 70 kDa, p10-binding protein
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NHQ1
Immunogen:
The immunogen for Anti-CEP70 antibody is: synthetic peptide directed towards the N-terminal region of Human CEP70. Synthetic peptide located within the following region: MFPVAPKPQDSSQPSDRLMTEKQQEEAEWESINVLLMMHGLKPLSLVKRT.
GeneID:
80321
Application WB
Background CEP70 plays a role in the organization of both preexisting and scent microtubules in interphase cells. During mitosis, it is required for the organization and orientation of the mitotic spindle.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CEP70 (2 products)

Catalog No. Species Pres. Purity   Source  

CEP70

CEP70 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CEP70

CEP70 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn