TA344289 UQCRFS1 (Complex III subunit Rieske) antibody

Rabbit Polyclonal Anti-UQCRFS1 Antibody - N-terminal region

See related secondary antibodies

Search for all "UQCRFS1 (Complex III subunit Rieske)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine UQCRFS1 (Complex III subunit Rieske)

Product Description for UQCRFS1 (Complex III subunit Rieske)

Rabbit anti Canine UQCRFS1 (Complex III subunit Rieske).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UQCRFS1 (Complex III subunit Rieske)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Complex III subunit 5, Cytochrome b-c1 complex subunit Rieske, Rieske iron-sulfur protein, Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial
Presentation Purified
Reactivity Can
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P47985
Immunogen:
The immunogen for anti-UQCRFS1 antibody: synthetic peptide directed towards the N terminal of human UQCRFS1. Synthetic peptide located within the following region: MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL.
GeneID:
7386
Application WB
Background UQCRFS1 is the component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for UQCRFS1 (Complex III subunit Rieske) (2 products)

Catalog No. Species Pres. Purity   Source  

UQCRFS1 (Complex III subunit Rieske)

UQCRFS1 (Complex III subunit Rieske) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

UQCRFS1 (Complex III subunit Rieske)

UQCRFS1 (Complex III subunit Rieske) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for UQCRFS1 (Complex III subunit Rieske) (1 products)

Catalog No. Species Pres. Purity   Source  

UQCRFS1 overexpression lysate

UQCRFS1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn