TA344298 Secernin-2 (SCRN2) antibody

Rabbit Polyclonal Anti-SCRN2 Antibody - N-terminal region

See related secondary antibodies

Search for all "Secernin-2 (SCRN2)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Secernin-2 (SCRN2)

Product Description for Secernin-2 (SCRN2)

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Secernin-2 (SCRN2).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Secernin-2 (SCRN2)

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96FV2
Immunogen:
The immunogen for anti-SCRN2 antibody: synthetic peptide directed towards the N terminal of human SCRN2. Synthetic peptide located within the following region: MASSSPDSPCSCDCFVSVPPASAIPAVIFAKNSDRPRDEVQEVVFVPAGT.
GeneID:
90507
Application WB
Background The exact function of SCRN2 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Secernin-2 (SCRN2) (1 products)

Catalog No. Species Pres. Purity   Source  

Secernin-2 (SCRN2) (transcript variant 1)

Secernin-2 (SCRN2) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for Secernin-2 (SCRN2) (3 products)

Catalog No. Species Pres. Purity   Source  

SCRN2 293T Cell Transient Overexpression Lysate(Denatured)

SCRN2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SCRN2 overexpression lysate

SCRN2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

SCRN2 overexpression lysate

SCRN2 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn