TA344299 SAMD8 / SMSr antibody

Rabbit Polyclonal Anti-SAMD8 Antibody - middle region

See related secondary antibodies

Search for all "SAMD8 / SMSr"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat SAMD8 / SMSr

Product Description for SAMD8 / SMSr

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat SAMD8 / SMSr.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SAMD8 / SMSr

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SAM domain-containing protein 8, Sphingomyelin synthase-related protein 1, Sterile alpha motif domain-containing protein 8
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96LT4
Immunogen:
The immunogen for anti-SAMD8 antibody: synthetic peptide directed towards the middle region of human SAMD8. Synthetic peptide located within the following region: MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL.
GeneID:
142891
Application WB
Background SAMD8 is a multi-pass membrane protein. It belongs to the sphingomyelin synthase family and contains 1 SAM (sterile alpha motif) domain. The function of the SAMD8 protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SAMD8 / SMSr (2 products)

Catalog No. Species Pres. Purity   Source  

SAMD8 / SMSr

SAMD8 / SMSr Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SAMD8 / SMSr

SAMD8 / SMSr Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for SAMD8 / SMSr (1 products)

Catalog No. Species Pres. Purity   Source  

SAMD8 overexpression lysate

SAMD8 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn