TA344300 RPL13A antibody

Rabbit Polyclonal Anti-RPL13A Antibody - middle region

See related secondary antibodies

Search for all "RPL13A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish RPL13A

Product Description for RPL13A

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish RPL13A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RPL13A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 23 kDa highly basic protein, 60S ribosomal protein L13a
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P40429
Immunogen:
The immunogen for anti-RPL13A antibody: synthetic peptide directed towards the middle region of human RPL13A. Synthetic peptide located within the following region: HEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKY.
GeneID:
23521
Application WB
Background Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 R species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pro
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RPL13A (2 products)

Catalog No. Species Pres. Purity   Source  

RPL13A

RPL13A Human Purified
  Abnova Taiwan Corp.

RPL13A

RPL13A Human Purified
  Abnova Taiwan Corp.
  • LinkedIn