TA344311 Olfactory receptor 10X1 antibody

Rabbit Polyclonal Anti-OR10X1 Antibody - middle region

See related secondary antibodies

Search for all "Olfactory receptor 10X1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Rabbit Olfactory receptor 10X1

Product Description for Olfactory receptor 10X1

Rabbit anti Canine, Rabbit Olfactory receptor 10X1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Olfactory receptor 10X1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms OR10X1, OR10X1P, Olfactory receptor OR1-14
Presentation Purified
Reactivity Can, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NGY0
Immunogen:
The immunogen for anti-OR10X1 antibody: synthetic peptide directed towards the middle region of human OR10X1. Synthetic peptide located within the following region: NIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHP.
GeneID:
128367
Application WB
Background OR10X1 is an odorant receptor.Olfactory receptors interact with odorant molecules in the nose, to initiate a neurol response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant sigls. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Olfactory receptor 10X1 (2 products)

Catalog No. Species Pres. Purity   Source  

Olfactory receptor 10X1

Olfactory receptor 10X1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Olfactory receptor 10X1

Olfactory receptor 10X1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Olfactory receptor 10X1 (1 products)

Catalog No. Species Pres. Purity   Source  

OR10X1 overexpression lysate

OR10X1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn