Home » Galectin-1

TA344315 Galectin-1 antibody

Rabbit Polyclonal Anti-LGALS1 Antibody - middle region

0.1 ml / €360.00

Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

View Datasheet

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Porcine, Rat Galectin-1

More Views

Product Description for Galectin-1

Rabbit anti Bovine, Canine, Guinea Pig, Human, Porcine, Rat Galectin-1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Galectin-1

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	14 kDa lectin, Beta-galactoside-binding lectin L-14-I, Galaptin, Galectin1, HBL, HPL, LGALS1, Lactose-binding lectin 1, Lectin galactoside-binding soluble 1, MAPK-activating protein PM12, S-Lac lectin 1
Presentation	Purified
Reactivity	Bov, Can, GP, Hu, Por, Rt
Applications	P, WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Datasheet Extract

Immunogen	Swiss Prot Num: P09382 Immunogen: The immunogen for anti-LGALS1 antibody: synthetic peptide directed towards the middle region of human LGALS1. Synthetic peptide located within the following region: EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM. GeneID: 3956
Application	IHC WB
Background	The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS1 may act as an autocrine negative growth factor that regulates cell proliferation.The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS1 may act as an autocrine negative growth factor that regulates cell proliferation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format	Purification: Affinity Purified Buffer System: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Galectin-1 (14 products)

Catalog No.	Species	Pres.	Purity	Source
TP304674	Galectin-1
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
TP723123	Galectin-1
	Human		> 95 % Preparation: . Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.	E. coli	50 µg / €230.00
					OriGene Technologies, Inc.
AR09268PU-L	Galectin-1 (1-135)
	Human	Purified	> 90 % by SDS - PAGE	E. coli	0.5 mg / €600.00
					OriGene Technologies GmbH
AR09268PU-N	Galectin-1 (1-135)
	Human	Purified	> 90 % by SDS - PAGE	E. coli	0.1 mg / €250.00
					OriGene Technologies GmbH
AR31162PU-N	Galectin-1
	Human	Purified	> 95 % by SDS-PAGE and Silver staining	E. coli	50 µg / €270.00
					OriGene Technologies GmbH
PA227	Galectin-1
	Human	Purified	> 98 % pure by SDS-PAGE and HPLC analysis.	E. coli
					OriGene Technologies GmbH
PA227X	Galectin-1
	Human	Purified	> 98 % pure by SDS-PAGE and HPLC analysis.	E. coli
					OriGene Technologies GmbH
H00003956-P01-10	Galectin-1
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00003956-P01-25	Galectin-1
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00003956-Q02	Galectin-1
	Human	Purified
					Abnova Taiwan Corp.
H00003956-Q02-10	Galectin-1
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00003956-Q02-25	Galectin-1
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
P4390	Galectin-1
	Human
					Abnova Taiwan Corp.
NBP1-30230	Galectin-1

					Novus Biologicals Inc.

Positive controls for Galectin-1 (2 products)

Catalog No.	Species
NBL1-12496	Galectin 1 Lysate

		Novus Biologicals Inc.
LY400833	LGALS1 overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.

Recommended Secondary Antibodies for Galectin-1 (9 products)

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH

Click here to see all secondary antibodies for Galectin-1

Antibodies (see all»)

Kits (see all»)

Antigens

Lysates (see all»)

Tissue Slides (see all»)

Other life-science products