TA344328 FNTB antibody

Rabbit Polyclonal Anti-Fntb Antibody - N-terminal region

See related secondary antibodies

Search for all "FNTB"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Rat FNTB

Product Description for FNTB

Rabbit anti Human, Rat FNTB.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FNTB

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CAAX farnesyltransferase subunit beta, FTase-beta, Protein farnesyltransferase subunit beta, Ras proteins prenyltransferase subunit beta
Presentation Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q02293
Immunogen:
The immunogen for Anti-Fntb antibody is: synthetic peptide directed towards the N-terminal region of Rat Fntb. Synthetic peptide located within the following region: PEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREK.
GeneID:
64511
Application WB
Background Fntb is a beta subunit of a transferase enzyme; attaches a farnesyl group to cysteine in ras and other membrane-associated proteins.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn