TA344329 FKBP2 / FKBP13 antibody

Rabbit Polyclonal Anti-FKBP2 Antibody - N-terminal region

See related secondary antibodies

Search for all "FKBP2 / FKBP13"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Goat, Human, Mouse, Rat, Zebrafish FKBP2 / FKBP13

Product Description for FKBP2 / FKBP13

Rabbit anti Bovine, Canine, Goat, Human, Mouse, Rat, Zebrafish FKBP2 / FKBP13.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FKBP2 / FKBP13

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FK506-binding protein 2, FKBP-13, FKBP-2, Immunophilin FKBP13, Peptidyl-prolyl cis-trans isomerase FKBP2, Rotamase
Presentation Purified
Reactivity Bov, Can, Gt, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P26885
Immunogen:
The immunogen for anti-FKBP2 antibody: synthetic peptide directed towards the N terminal of human FKBP2. Synthetic peptide located within the following region: RLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDV.
GeneID:
2286
Application WB
Background FKBP2 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Multiple altertively spliced variants, encoding the same protein, have been identified.The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. This gene has two altertively spliced transcript variants that encode the same isoform. Multiple polyadenylation sites have been described for this gene, but the full length ture of this gene has not been determined.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FKBP2 / FKBP13 (12 products)

Catalog No. Species Pres. Purity   Source  

FKBP2 / FKBP13 (transcript variant 2)

FKBP2 / FKBP13 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FKBP2 / FKBP13 (transcript variant 1)

FKBP2 / FKBP13 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FKBP2 / FKBP13 (transcript variant 3)

FKBP2 / FKBP13 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FKBP2 / FKBP13 (transcript variant 2)

FKBP2 / FKBP13 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €299.00
  OriGene Technologies, Inc.

FKBP2 / FKBP13 (22-142)

FKBP2 / FKBP13 Human Purified > 90 % by SDS – PAGE E. coli
0.25 mg / €820.00
  OriGene Technologies GmbH

FKBP2 / FKBP13 (22-142)

FKBP2 / FKBP13 Human Purified > 90 % by SDS – PAGE E. coli
50 µg / €320.00
  OriGene Technologies GmbH

FKBP2 / FKBP13

FKBP2 / FKBP13 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FKBP2 / FKBP13

FKBP2 / FKBP13 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FKBP2 / FKBP13

FKBP2 / FKBP13 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FKBP2 / FKBP13

FKBP2 / FKBP13 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FKBP2 / FKBP13

FKBP2 / FKBP13 Human
  Abnova Taiwan Corp.

FKBP2 / FKBP13

SDS-Page: FKBP2 Protein [NBP1-41233] - FKBP2, 13.4 kDa (122aa), confirmed by MALDI-TOF with a purity of 90% by SDS - PAGE
  Novus Biologicals Inc.

Positive controls for FKBP2 / FKBP13 (2 products)

Catalog No. Species Pres. Purity   Source  

FKBP2 Lysate

Western Blot: FKBP2 Lysate [NBL1-10735] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for FKBP2.
  Novus Biologicals Inc.

FKBP2 Lysate

Western Blot: FKBP2 Lysate [NBL1-10736] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FKBP2
  Novus Biologicals Inc.
  • LinkedIn