TA344331 Erlin-2 antibody

Rabbit Polyclonal Anti-ERLIN2 Antibody - middle region

See related secondary antibodies

Search for all "Erlin-2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Porcine, Rabbit Erlin-2

TA344331

More Views

  • TA344331
  • TA344331
  • TA344331
  • TA344331
  • TA344331
  • TA344331

Product Description for Erlin-2

Rabbit anti Human, Porcine, Rabbit Erlin-2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Erlin-2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C8orf2, Endoplasmic reticulum lipid raft-associated protein 2, Erlin 2, PRO5003, PRO9924, SPFH domain-containing protein 2, SPFH2, Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2
Presentation Purified
Reactivity Hu, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O94905
Immunogen:
The immunogen for anti-ERLIN2 antibody: synthetic peptide directed towards the middle region of human ERLIN2. Synthetic peptide located within the following region: ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN.
GeneID:
11160
Application WB
Background ERLIN2 plays an important role in the early steps of the endoplasmic reticulum-associated degradation (ERAD) pathway. It is involved in ITPR1 degradation by the ERAD pathway.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Erlin-2 (4 products)

Catalog No. Species Pres. Purity   Source  

Erlin-2 (25-339, His-tag)

Erlin-2 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

Erlin-2 (25-339, His-tag)

Erlin-2 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

Erlin-2

Erlin-2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Erlin-2

Erlin-2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn