TA344332 EPHA5 antibody

Rabbit Polyclonal Anti-EPHA5 Antibody - middle region

See related secondary antibodies

Search for all "EPHA5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat EPHA5

Product Description for EPHA5

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat EPHA5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EPHA5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms EHK1, EPH homology kinase 1, Ephrin type-A receptor 5, HEK7, Receptor protein-tyrosine kinase HEK7, Tyrosine-protein kinase receptor EHK-1
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P54756
Immunogen:
The immunogen for anti-EPHA5 antibody: synthetic peptide directed towards the middle region of human EPHA5. Synthetic peptide located within the following region: SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIP.
GeneID:
2044
Application WB
Background EPHA5 belongs to the ephrin receptor subfamily of the protein-tyrosine kise family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kise domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Two transcript variants encoding different isoforms have been found for this gene.This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kise family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kise domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for EPHA5 (7 products)

Catalog No. Species Pres. Purity   Source  

EPHA5 (C-term DDK/His tag, transcript variant 1)

EPHA5 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

EPHA5 (C-term DDK tag, transcript variant 1)

EPHA5 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
SF9 cells
20 µg / €411.00
  OriGene Technologies, Inc.

EPHA5

EPHA5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EPHA5

EPHA5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EPHA5

EPHA5 Human
  Abnova Taiwan Corp.

EPHA5

EPHA5 Human
  Abnova Taiwan Corp.

EPHA5

EPHA5 Human
  Abnova Taiwan Corp.

Positive controls for EPHA5 (1 products)

Catalog No. Species Pres. Purity   Source  

EPHA5 overexpression lysate

EPHA5 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn