CDK1 - TA344355 | acris-antibodies.com

Product Description for CDK1

Rabbit anti CDK1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CDK1

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	CDC2, CDC28A, CDK1, CDKN1, Cell division control protein 2 homolog, Cell division protein kinase 1, Cyclin-dependent kinase 1, P34CDC2, p34 protein kinase
Presentation	Purified
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Datasheet Extract

Immunogen	Swiss Prot Num: P06493 Immunogen: The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF. GeneID: 983
Application	WB
Background	The protein encoded by CDC2 is a member of the Ser/Thr protein kise family. This protein is a catalytic subunit of the highly conserved protein kise complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kise activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control.The protein encoded by this gene is a member of the Ser/Thr protein kise family. This protein is a catalytic subunit of the highly conserved protein kise complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kise activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control.
Format	Purification: Affinity Purified Buffer System: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CDK1 (21 products)

Catalog No.	Species	Pres.	Purity	Source
P4640	CDC2/CCNB1
	Human			Sf9 Insect cells
					Abnova Taiwan Corp.
TP300495	CDK1 (transcript variant 1)
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
AR51697PU-N	CDK1 (1-297, His-tag)
	Human	Purified	> 95 % by SDS - PAGE		0.25 mg / €1,070.00
					OriGene Technologies GmbH
AR51697PU-S	CDK1 (1-297, His-tag)
	Human	Purified	> 95 % by SDS - PAGE		50 µg / €400.00
					OriGene Technologies GmbH
AR51832PU-N	CDK1 (1-297, His-tag)
	Human	Purified	> 85 % by SDS - PAGE	E. coli	0.5 mg / €820.00
					OriGene Technologies GmbH
AR51832PU-S	CDK1 (1-297, His-tag)
	Human	Purified	> 85 % by SDS - PAGE	E. coli	0.1 mg / €320.00
					OriGene Technologies GmbH
H00000983-P01-10	CDK1
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00000983-P01-25	CDK1
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00000983-Q01-10	CDK1
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00000983-Q01-25	CDK1
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00000983-Q02-10	CDK1
	Human			in vitro transl.
					Abnova Taiwan Corp.
H00000983-Q02-25	CDK1
	Human			in vitro transl.
					Abnova Taiwan Corp.
P0496	CDK1
	Human
					Abnova Taiwan Corp.
P0497	CDK1
	Human
					Abnova Taiwan Corp.
P1294	CDK1
	Human
					Abnova Taiwan Corp.
P1296	CDK1
	Human
					Abnova Taiwan Corp.
P2521	CDK1
	Human
					Abnova Taiwan Corp.
P2522	CDK1
	Human
					Abnova Taiwan Corp.
P4639	CDK1
	Human
					Abnova Taiwan Corp.
P4641	CDK1
	Human
					Abnova Taiwan Corp.
P5508	CDK1
	Human
					Abnova Taiwan Corp.

Positive controls for CDK1 (1 products)

Catalog No.	Species
NBL1-08991	Cdc2 Lysate

		Novus Biologicals Inc.

Recommended Secondary Antibodies for CDK1 (9 products)

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH