TA344375 TINF2 / TIN2 antibody

Rabbit Polyclonal Anti-TINF2 Antibody - middle region

See related secondary antibodies

Search for all "TINF2 / TIN2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine TINF2 / TIN2

TA344375

More Views

  • TA344375

Product Description for TINF2 / TIN2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine TINF2 / TIN2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TINF2 / TIN2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms TERF1-interacting nuclear factor 2, TRF1-interacting nuclear protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BSI4
Immunogen:
The immunogen for anti-TINF2 antibody: synthetic peptide directed towards the middle region of human TINF2. Synthetic peptide located within the following region: SDEEENGQGEGKESLENYQKTKFDTLIPTLCEYLPPSGHGAIPVSSCDCR.
GeneID:
26277
Application WB
Background TINF2 is a component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the D damage surveillance and chromosome ends are ippropriately processed by D repair pathways. It plays a role in shelterin complex assembly.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TINF2 / TIN2 (2 products)

Catalog No. Species Pres. Purity   Source  

TINF2 / TIN2

TINF2 / TIN2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TINF2 / TIN2

TINF2 / TIN2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TINF2 / TIN2 (3 products)

Catalog No. Species Pres. Purity   Source  

TIN2 Lysate

Western Blot: TIN2 Lysate [NBL1-16930] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TINF2
  Novus Biologicals Inc.

TINF2 293T Cell Transient Overexpression Lysate(Denatured)

TINF2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TINF2 overexpression lysate

TINF2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn