TA344377 SYCP1 / SCP1 antibody

Rabbit Polyclonal Anti-SYCP1 Antibody - N-terminal region

See related secondary antibodies

Search for all "SYCP1 / SCP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat SYCP1 / SCP1

TA344377

More Views

  • TA344377

Product Description for SYCP1 / SCP1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat SYCP1 / SCP1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SYCP1 / SCP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cancer/testis antigen 8, HOM-TES-14, SCP-1, Synaptonemal complex protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15431
Immunogen:
The immunogen for anti-SYCP1 antibody: synthetic peptide directed towards the N terminal of human SYCP1. Synthetic peptide located within the following region: NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV.
GeneID:
6847
Application WB
IHC
Background SYCP1 is a major component of the transverse filaments of syptonemal complexes (SCS), which is formed between homologous chromosomes during meiotic prophase.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SYCP1 / SCP1 (1 products)

Catalog No. Species Pres. Purity   Source  

SYCP1 / SCP1

SYCP1 / SCP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.
  • LinkedIn