TA344390 H2AFY / MACROH2A1 antibody

Rabbit Polyclonal Anti-H2AFY Antibody - middle region

See related secondary antibodies

Search for all "H2AFY / MACROH2A1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Mouse, Porcine, Rat H2AFY / MACROH2A1

Product Description for H2AFY / MACROH2A1

Rabbit anti Bovine, Canine, Equine, Mouse, Porcine, Rat H2AFY / MACROH2A1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for H2AFY / MACROH2A1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Core histone macro-H2A.1, H2A.y, H2A/y, Histone macroH2A1, MU-MB-50.205, Medulloblastoma antigen MU-MB-50.205, mH2A1
Presentation Purified
Reactivity Bov, Can, Eq, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75367
Immunogen:
The immunogen for anti-H2AFY antibody: synthetic peptide directed towards the middle region of human H2AFY. Synthetic peptide located within the following region: PVSKKAGGKKGARKSKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLG.
GeneID:
9555
Application WB
Background Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of D wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the D between the nucleosomes to form higher order chromatin structures. H2AFY is a member of the histone H2A family. It replaces conventiol H2A histones in a subset of nucleosomes where it represses transcription and participates in stable X chromosome ictivation. Altertive splicing results in multiple transcript variants encoding different isoforms.Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of D wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the D between the nucleosomes to form higher order chromatin structures. This gene encodes a member of the histone H2A family. It replaces conventiol H2A histones in a subset of nucleosomes where it represses transcription and participates in stable X chromosome ictivation. Altertive splicing results in multiple transcript variants encoding different isoforms.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for H2AFY / MACROH2A1 (3 products)

Catalog No. Species Pres. Purity   Source  

H2AFY / MACROH2A1 (transcript variant 2)

H2AFY / MACROH2A1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

H2AFY / MACROH2A1

H2AFY / MACROH2A1 Human Purified
  Abnova Taiwan Corp.

H2AFY / MACROH2A1

H2AFY / MACROH2A1 Human Purified
  Abnova Taiwan Corp.

Positive controls for H2AFY / MACROH2A1 (4 products)

Catalog No. Species Pres. Purity   Source  

H2AFY overexpression lysate

H2AFY overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

H2AFY overexpression lysate

H2AFY overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

H2AFY overexpression lysate

H2AFY overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

macroH2A.1 Lysate

Western Blot: macroH2A.1 Lysate [NBL1-11425] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for H2AFY
  Novus Biologicals Inc.
  • LinkedIn