TA344396 CDCA5 / Sororin antibody

Rabbit Polyclonal Anti-CDCA5 Antibody - middle region

See related secondary antibodies

Search for all "CDCA5 / Sororin"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CDCA5 / Sororin

Product Description for CDCA5 / Sororin

Rabbit anti Human CDCA5 / Sororin.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CDCA5 / Sororin

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cell division cycle-associated protein 5, p35
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96FF9
Immunogen:
The immunogen for anti-CDCA5 antibody: synthetic peptide directed towards the middle region of human CDCA5. Synthetic peptide located within the following region: ATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTST.
GeneID:
113130
Application WB
Background CDCA5 is the regulator of sister chromatid cohesion in mitosis. It may act by regulating the ability of the cohesin complex to mediate sister chromatid cohesion, perhaps by altering the ture of the interaction of cohesin with the chromosomes.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CDCA5 / Sororin (2 products)

Catalog No. Species Pres. Purity   Source  

CDCA5 / Sororin

CDCA5 / Sororin Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CDCA5 / Sororin

CDCA5 / Sororin Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for CDCA5 / Sororin (2 products)

Catalog No. Species Pres. Purity   Source  

CDCA5 293T Cell Transient Overexpression Lysate(Denatured)

CDCA5 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CDCA5 Lysate

Western Blot: CDCA5 Lysate [NBL1-09019] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for CDCA5.
  Novus Biologicals Inc.
  • LinkedIn