TA344403 TFPI2 antibody

Rabbit Polyclonal Anti-TFPI2 Antibody - middle region

See related secondary antibodies

Search for all "TFPI2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human TFPI2

TA344403

More Views

  • TA344403

Product Description for TFPI2

Rabbit anti Human TFPI2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for TFPI2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PP5, Placental protein 5, TFPI-2, Tissue factor pathway inhibitor 2
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P48307
Immunogen:
The immunogen for anti-TFPI2 antibody: synthetic peptide directed towards the middle region of human TFPI2. Synthetic peptide located within the following region: NANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMT.
GeneID:
7980
Application WB
IHC
Background TFPI2 may play a role in the regulation of plasmin-mediated matrix remodeling. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 has no effect on thrombin.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TFPI2 (5 products)

Catalog No. Species Pres. Purity   Source  

TFPI2 (full length, N-term HIS tag)

TFPI2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

TFPI2

TFPI2 Human
  Abnova Taiwan Corp.

TFPI2

TFPI2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TFPI2

TFPI2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TFPI2

TFPI2 Human
  Abnova Taiwan Corp.

Positive controls for TFPI2 (3 products)

Catalog No. Species Pres. Purity   Source  

TFPI2 293T Cell Transient Overexpression Lysate(Denatured)

TFPI2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TFPI2 Lysate

Western Blot: TFPI2 Lysate [NBL1-16847] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TFPI2
  Novus Biologicals Inc.

TFPI2 overexpression lysate

TFPI2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn