TA344418 FOX1 / A2BP1 antibody

Rabbit Polyclonal Anti-A2BP1 Antibody - middle region

See related secondary antibodies

Search for all "FOX1 / A2BP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rat FOX1 / A2BP1

Product Description for FOX1 / A2BP1

Rabbit anti Bovine, Canine, Human, Mouse, Rat FOX1 / A2BP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FOX1 / A2BP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Ataxin-2-binding protein 1, HRNBP1, Hexaribonucleotide-binding protein 1
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NWB1
Immunogen:
The immunogen for anti-A2BP1 antibody: synthetic peptide directed towards the middle region of human A2BP1. Synthetic peptide located within the following region: TAAAYSDRNQFVFVAADEISCNTSAVTDEFMLPTPTTTHLLQPPPTALVP.
GeneID:
54715
Application WB
Background Ataxin-2 binding protein 1(A2BP1) has an RNP motif that is highly conserved among R-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the gene product of the SCA2 gene which causes familial neurodegenerative diseases. Ataxin-2 binding protein 1 and ataxin-2 are both localized in the trans-Golgi network. Several altertively spliced transcript variants encoding different isoforms have been found for this gene. Additiol transcript variants have been found but their full length ture has not been determined.Ataxin-2 binding protein 1 has an RNP motif that is highly conserved among R-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the gene product of the SCA2 gene which causes familial neurodegenerative diseases. Ataxin-2 binding protein 1 and ataxin-2 are both localized in the trans-Golgi network. Four altertively spliced transcript variants have been found for this gene. Additiol transcript variants have been found but their full length ture has not been determined.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FOX1 / A2BP1 (1 products)

Catalog No. Species Pres. Purity   Source  

FOX1 / A2BP1 (transcript variant 4)

FOX1 / A2BP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for FOX1 / A2BP1 (7 products)

Catalog No. Species Pres. Purity   Source  

A2BP1 Lysate

Western Blot: A2BP1 Lysate [NBL1-07156] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for A2BP1 Protein
  Novus Biologicals Inc.

RBFOX1 overexpression lysate

RBFOX1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

RBFOX1 overexpression lysate

RBFOX1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

RBFOX1 overexpression lysate

RBFOX1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

RBFOX1 overexpression lysate

RBFOX1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

RBFOX1 overexpression lysate

RBFOX1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

RBFOX1 overexpression lysate

RBFOX1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn