TA344427 SCAND2 antibody

Rabbit Polyclonal Anti-SCAND2 Antibody - middle region

See related secondary antibodies

Search for all "SCAND2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SCAND2

Product Description for SCAND2

Rabbit anti Human SCAND2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SCAND2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Putative SCAN domain-containing protein 2, SCAND-2
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9GZW5
Immunogen:
The immunogen for anti-SCAND2 antibody: synthetic peptide directed towards the middle region of human SCAND2. Synthetic peptide located within the following region: IQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL.
GeneID:
54581
Application WB
Background The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa origilly found within a subfamily of zinc finger proteins. Functiol studies have established that the SCAN box is a protein interaction domain that mediates both hetero- and homoprotein associations, and maybe involved in regulation of transcriptiol activity.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SCAND2 (2 products)

Catalog No. Species Pres. Purity   Source  

SCAND2

SCAND2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

SCAND2

SCAND2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

Positive controls for SCAND2 (1 products)

Catalog No. Species Pres. Purity   Source  

SCAND2 293T Cell Transient Overexpression Lysate(Denatured)

SCAND2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn