TA344441 AIP / XAP2 antibody

Rabbit Polyclonal Anti-AIP Antibody - N-terminal region

See related secondary antibodies

Search for all "AIP / XAP2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Rat AIP / XAP2

Product Description for AIP / XAP2

Rabbit anti Bovine, Canine, Equine, Human, Rat AIP / XAP2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for AIP / XAP2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AH receptor-interacting protein, ARA9, Aryl-hydrocarbon receptor-interacting protein, HBV X-associated protein 2, Immunophilin homolog ARA9
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O00170
Immunogen:
The immunogen for anti-AIP antibody: synthetic peptide directed towards the N terminal of human AIP. Synthetic peptide located within the following region: FHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKLPVWETIVCTMREGEI.
GeneID:
9049
Application WB
Background AIP may play a positive role in AHR-mediated siglling possibly by influencing its receptivity for ligand and/or its nuclear targeting. AIP is the cellular negative regulator of the HBV X protein. AIP may play a positive role in AHR-mediated siglling possibly by influencing its receptivity for ligand and/or its nuclear targeting. AIP is the cellular negative regulator of the HBV X protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for AIP / XAP2 (6 products)

Catalog No. Species Pres. Purity   Source  

AIP / XAP2

AIP / XAP2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

AIP / XAP2 (1-330, His-tag)

AIP / XAP2 Human Purified > 90 % E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

AIP / XAP2 (1-330, His-tag)

AIP / XAP2 Human Purified > 90 % E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

AIP / XAP2

AIP / XAP2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

AIP / XAP2

AIP / XAP2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

AIP / XAP2

AIP / XAP2 Human
  Abnova Taiwan Corp.
  • LinkedIn