TA344488 HOXB3 / HOX2G antibody

Rabbit Polyclonal Anti-HOXB3 Antibody - middle region

See related secondary antibodies

Search for all "HOXB3 / HOX2G"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human, Mouse, Porcine, Rabbit, Rat HOXB3 / HOX2G

Product Description for HOXB3 / HOX2G

Rabbit anti Bovine, Human, Mouse, Porcine, Rabbit, Rat HOXB3 / HOX2G.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HOXB3 / HOX2G

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Homeobox protein Hox-B3, Hox-2.7, Hox-2G
Presentation Purified
Reactivity Bov, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P14651
Immunogen:
The immunogen for anti-HOXB3 antibody: synthetic peptide directed towards the middle region of human HOXB3. Synthetic peptide located within the following region: SGNLDYNGAPPMAPSQHHGPCEPHPTYTDLSSHHAPPPQGRIQEAPKLTH.
GeneID:
3213
Application WB
Background HOXB3 belongs to ANTP homeobox family. It is a nuclear protein with a homeobox D-binding domain. HOXB3 gene is included in a cluster of homeobox B genes located on chromosome 17. The protein functions as a sequence-specific transcription factor that is involved in development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML).
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HOXB3 / HOX2G (2 products)

Catalog No. Species Pres. Purity   Source  

HOXB3 / HOX2G

HOXB3 / HOX2G Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

HOXB3 / HOX2G

HOXB3 / HOX2G Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn